PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN29688.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 391aa    MW: 44639.1 Da    PI: 5.4633
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN29688.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK42.51.3e-13289336350
      RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50 
                 ++++l+dls  F+ ++k+A + L++++T++K iCR+  +  WPhR+++
  KHN29688.1 289 NSMTLDDLSGVFHITMKAAKNVLDMSVTAIKSICRKCRLYKWPHRQLQ 336
                 689*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.424270358IPR003035RWP-RK domain
PfamPF020422.1E-13290336IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MDNNNNNNIN SSVFVSYVCR DPFVSPLLDN FNEPDPALVY LLPEPNLRND EQQPLQGHVS  60
STDSTIHDQS HHYCNDNFTI GGGVFPNYEF VEGSSKNKRK YPFTDTDIED QSFMHDFEAG  120
PSNLNQPASG NMGPRNWPPM PRPFFCTCCQ VLRQTIHTNG TDFERLEIHG RIGLISHIII  180
QNQSITPGGR SCDNYQMIDF TNGSPAEVKG FLEDYIARKD KLGYIIAEES FSEFYEAVCT  240
KLDWVGKRTN NEDDDLTPQN VEEEPEPEPE PPKERRRKRS RKDQSDRINS MTLDDLSGVF  300
HITMKAAKNV LDMSVTAIKS ICRKCRLYKW PHRQLQPLAR RLKVLKRALE SSQDPVVIQT  360
TSMEVRRIKQ HMTQLCGGVT PTGIEIPEVE E
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1275282RRKRSRKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014628100.11e-145PREDICTED: uncharacterized protein LOC106794188
RefseqXP_014630526.11e-147PREDICTED: uncharacterized protein LOC102665948
TrEMBLA0A0B2RCS70.0A0A0B2RCS7_GLYSO; Protein NLP6
STRINGGLYMA04G05755.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]